discontinued

H00056658-B02 TRIM39 / RNF23 antibody

See related secondary antibodies

Search for all "TRIM39 / RNF23"

Quick Overview

Mouse anti Human TRIM39 / RNF23

H00056658-B02

More Views

  • H00056658-B02
  • H00056658-B02

Product Description for TRIM39 / RNF23

Mouse anti Human TRIM39 / RNF23.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TRIM39 / RNF23

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms RING finger protein 23, Testis-abundant finger protein, Tripartite motif-containing protein 39
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCM9
Immunogen:
TRIM39 (AAH07661, 1 a.a. ~ 488 a.a) full-length human protein.
AA Sequence:
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCRKTSRYR SLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQEYKE KLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRE NAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQ LIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVC RDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDT FTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE
GeneID:
56658
Remarks:
Gene Accession: BC007661
Add. information Mouse polyclonal antibody raised against a full-length human TRIM39 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 56658

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM39 / RNF23 (5 products)

Catalog No. Species Pres. Purity   Source  

TRIM39 / RNF23 (transcript variant 2)

TRIM39 / RNF23 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM39 / RNF23 (3 products)

Catalog No. Species Pres. Purity   Source  

RNF23 Lysate

Western Blot: RNF23 Lysate [NBL1-17295] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TRIM39.
  Novus Biologicals Inc.

TRIM39 293T Cell Transient Overexpression Lysate(Denatured)

TRIM39 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23
  Abnova Taiwan Corp.
  • LinkedIn