TA337804 TRIM39 / RNF23 antibody

Rabbit Polyclonal Anti-TRIM39 Antibody

See related secondary antibodies

Search for all "TRIM39 / RNF23"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat TRIM39 / RNF23

Product Description for TRIM39 / RNF23

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat TRIM39 / RNF23.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM39 / RNF23

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms RING finger protein 23, Testis-abundant finger protein, Tripartite motif-containing protein 39
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCM9
Immunogen:
Synthetic peptide directed towards the N terminal of Human TRIM39
AA Sequence:
HTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVE
GeneID:
56658
Application Western Blot (1-3 µg/ml) using a cell lysate as a positive control.
Background The protein encoded by TRIM39 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6.
Concentration 1.0 mg/ml (after reconstitution)
General Readings
  1. Reymond,A., et al., (2001) EMBO J. 20 (9), 2140-2151
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Affinity Chromatography on Protein A
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Bovine, Guinea pig, Horse, Human, Pig, Rabbit, Mouse, Rat.
Species reactivity (tested):
Human, Dog, Mouse, Rat, Bovine, Pig.
Specificity
Specificity:
This is a Rabbit polyclonal antibody against TRIM39.

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM39 / RNF23 (5 products)

Catalog No. Species Pres. Purity   Source  

TRIM39 / RNF23 (transcript variant 2)

TRIM39 / RNF23 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM39 / RNF23 (3 products)

Catalog No. Species Pres. Purity   Source  

RNF23 Lysate

Western Blot: RNF23 Lysate [NBL1-17295] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TRIM39.
  Novus Biologicals Inc.

TRIM39 293T Cell Transient Overexpression Lysate(Denatured)

TRIM39 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIM39 / RNF23

TRIM39 / RNF23
  Abnova Taiwan Corp.
  • LinkedIn