discontinued

H00135644-B01P TRIM40 / RNF35 antibody

See related secondary antibodies

Search for all "TRIM40 / RNF35"

Quick Overview

Mouse anti Human TRIM40 / RNF35

H00135644-B01P

More Views

  • H00135644-B01P
  • H00135644-B01P

Product Description for TRIM40 / RNF35

Mouse anti Human TRIM40 / RNF35.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TRIM40 / RNF35

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms RING finger protein 35, Tripartite motif-containing protein 40
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P9F5
Immunogen:
TRIM40 (AAH60785.1, 1 a.a. ~ 258 a.a) full-length human protein.
AA Sequence:
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQK RVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDH GNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLL NRSAPQKLEVIYPQLEKGVSELLLQPPQKL
GeneID:
135644
Remarks:
Gene Accession: BC060785.1
Add. information Mouse polyclonal antibody raised against a full-length human TRIM40 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 135644

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM40 / RNF35 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM40 / RNF35

TRIM40 / RNF35 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM40 / RNF35

TRIM40 / RNF35 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TRIM40 / RNF35 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM40 293T Cell Transient Overexpression Lysate(Denatured)

TRIM40 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIM40 overexpression lysate

TRIM40 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn