TA344502 TRIM58 / BIA2 antibody

Rabbit Polyclonal Anti-TRIM58 Antibody - middle region

See related secondary antibodies

Search for all "TRIM58 / BIA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TRIM58 / BIA2

Product Description for TRIM58 / BIA2

Rabbit anti Human TRIM58 / BIA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM58 / BIA2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Tripartite motif-containing protein 58
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NG06
Immunogen:
The immunogen for anti-TRIM58 antibody: synthetic peptide directed towards the middle region of human TRIM58. Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH.
GeneID:
25893
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM58 / BIA2 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIM58 / BIA2

TRIM58 / BIA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM58 / BIA2

TRIM58 / BIA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM58 / BIA2

TRIM58 / BIA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM58 / BIA2 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM58 Lysate

Western Blot: TRIM58 Lysate [NBL1-17308] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM58
  Novus Biologicals Inc.

TRIM58 overexpression lysate

TRIM58 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn