TA343450 TRIP10 antibody

Rabbit Polyclonal Anti-TRIP10 Antibody

See related secondary antibodies

Search for all "TRIP10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat, Zebrafish, African clawed frog TRIP10

Product Description for TRIP10

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat, Zebrafish, African clawed frog TRIP10.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIP10

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CIP4, Cdc42-interacting protein 4, Protein Felic, STOT, STP, Salt tolerant protein, TRIP-10, Thyroid receptor-interacting protein 10
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15642
Immunogen:
The immunogen for anti-TRIP10 antibody: synthetic peptide directed towards the middle region of human TRIP10.
AA Sequence:
FEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
GeneID:
9322
Application

Western blotting (0.2 - 1 µg/ml)

Background TRIP10 is required for translocation of GLUT4 to the plasma membrane in response to insulin signaling and to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. It binds to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promotes membrane invagination and the formation of tubules and also promotes CDC42-induced actin polymerization by recruiting WASL/N-WASP which in turn activates the Arp2/3 complex. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. TRIP10 is further required for the formation of podosomes, actin-rich adhesion structures specific to monocyte-derived cells and may be required for the lysosomal retention of FASLG/FASL.
General Readings "Microtubule-dependent formation of podosomal adhesion structures in primary human macrophages." Linder S., Huefner K., Wintergerst U., Aepfelbacher M. J. Cell Sci. 113:4165-4176(2000)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Rat, Mouse, Bovine, Zebrafish, African clawed frog, Rabbit
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIP10 (7 products)

Catalog No. Species Pres. Purity   Source  

TRIP10

TRIP10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIP10 (260-545, His-tag)

TRIP10 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

TRIP10 (260-545, His-tag)

TRIP10 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

TRIP10

TRIP10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

TRIP10

TRIP10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

TRIP10

TRIP10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP10

TRIP10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIP10 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIP10 overexpression lysate

TRIP10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn