discontinued

H00007205-D01P TRIP6 / OIP1 antibody

See related secondary antibodies

Search for all "TRIP6 / OIP1"

Quick Overview

Rabbit anti Human TRIP6 / OIP1

Product Description for TRIP6 / OIP1

Rabbit anti Human TRIP6 / OIP1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TRIP6 / OIP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms OIP-1, OPA-interacting protein 1, TRIP-6, ZRP-1, Zyxin-related protein 1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15654
Immunogen:
TRIP6 (NP_003293.2, 1 a.a. ~ 476 a.a) full-length human protein.
AA Sequence:
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQ HTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGP TPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAA GVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGC FVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVD ATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHIL CKACSAWRIQELSATVTTDC
GeneID:
7205
Remarks:
Gene Accession: NM_003302.2
Add. information Rabbit polyclonal antibody raised against a full-length human TRIP6 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7205

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIP6 / OIP1 (9 products)

Catalog No. Species Pres. Purity   Source  

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human Purified
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human Purified
  Novus Biologicals Inc.

TRIP6 / OIP1

TRIP6 / OIP1 Human Purified
  Novus Biologicals Inc.

Positive controls for TRIP6 / OIP1 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIP6 293T Cell Transient Overexpression Lysate(Denatured)

TRIP6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIP6 Lysate

Western Blot: TRIP6 Lysate [NBL1-17321] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TRIP6.
  Novus Biologicals Inc.

TRIP6 overexpression lysate

TRIP6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn