discontinued

H00007205-M04 TRIP6 / OIP1 antibody

See related secondary antibodies

Search for all "TRIP6 / OIP1"

Quick Overview

Mouse anti Human TRIP6 / OIP1 4B7

H00007205-M04

More Views

  • H00007205-M04
  • H00007205-M04
  • H00007205-M04

Product Description for TRIP6 / OIP1

Mouse anti Human TRIP6 / OIP1 4B7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TRIP6 / OIP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms OIP-1, OPA-interacting protein 1, TRIP-6, ZRP-1, Zyxin-related protein 1
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 4B7
Host Mouse
Isotype IgG3
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15654
Immunogen:
TRIP6 (NP_003293, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPP PPPAYRTGSLKPNPASPLPASP*
GeneID:
7205
Remarks:
Gene Accession: NM_003302
Isotype control AM03097PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant TRIP6.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7205

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIP6 / OIP1 (9 products)

Catalog No. Species Pres. Purity   Source  

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human Purified
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIP6 / OIP1

TRIP6 / OIP1 Human Purified
  Novus Biologicals Inc.

TRIP6 / OIP1

TRIP6 / OIP1 Human Purified
  Novus Biologicals Inc.

Positive controls for TRIP6 / OIP1 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIP6 293T Cell Transient Overexpression Lysate(Denatured)

TRIP6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIP6 Lysate

Western Blot: TRIP6 Lysate [NBL1-17321] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TRIP6.
  Novus Biologicals Inc.

TRIP6 overexpression lysate

TRIP6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn