discontinued

H00004915-B01 TrkB antibody

See related secondary antibodies

Search for all "TrkB"

Quick Overview

Mouse anti Human TrkB

Product Description for TrkB

Mouse anti Human TrkB.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TrkB

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BDNF/NT-3 growth factors receptor, GP145-TrkB, NTRK2, Neurotrophic tyrosine kinase receptor type 2, TRKB, TrkB tyrosine kinase
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16620
Immunogen:
NTRK2 (NP_001007098.1, 1 a.a. ~ 477 a.a) full-length human protein.
AA Sequence:
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQ KRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTC SCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNM YWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIP FTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMG WPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKL ARHSKFGMKGFVLFHKIPLDG
GeneID:
4915
Remarks:
Gene Accession: NM_001007097.1
Add. information Mouse polyclonal antibody raised against a full-length human NTRK2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 4915

Accessory Products

Proteins and/or Positive Controls

Proteins for TrkB (15 products)

Catalog No. Species Pres. Purity   Source  

TrkB (transcript variant b)

TrkB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TrkB (transcript variant a)

TrkB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TrkB (C-term DDK/His tag, transcript variant c)

TrkB Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TrkB (C-term DDK tag, transcript variant a)

TrkB Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €411.00
  OriGene Technologies, Inc.

TrkB (transcript variant b)

TrkB Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

TrkB (transcript variant b)

TrkB Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
  OriGene Technologies, Inc.

TrkB

TrkB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TrkB

TrkB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TrkB

TrkB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TrkB

TrkB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TrkB

TrkB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TrkB

TrkB Human
  Abnova Taiwan Corp.

TrkB

TrkB Human
  Abnova Taiwan Corp.

TrkB

TrkB Human
  Abnova Taiwan Corp.

TrkB

TrkB Human Purified
  Novus Biologicals Inc.

Positive controls for TrkB (6 products)

Catalog No. Species Pres. Purity   Source  

NTRK2 293T Cell Transient Overexpression Lysate(Denatured)

NTRK2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NTRK2 overexpression lysate

NTRK2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

NTRK2 overexpression lysate

NTRK2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

NTRK2 overexpression lysate

NTRK2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TrkB Lysate

Western Blot: TrkB Lysate [NBL1-13836] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NTRK2
  Novus Biologicals Inc.

TrkB Lysate

Western Blot: TrkB Lysate [NBL1-13837] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for NTRK2.
  Novus Biologicals Inc.
  • LinkedIn