discontinued

H00027037-B01 TRMT2A / HTF9C antibody

See related secondary antibodies

Search for all "TRMT2A / HTF9C"

Quick Overview

Mouse anti Human TRMT2A / HTF9C

H00027037-B01

More Views

  • H00027037-B01

Product Description for TRMT2A / HTF9C

Mouse anti Human TRMT2A / HTF9C.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TRMT2A / HTF9C

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms HpaII tiny fragments locus 9c protein, tRNA (uracil-5-)-methyltransferase homolog A
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZ69
Immunogen:
HTF9C (NP_073564.3, 1 a.a. ~ 625 a.a) full-length human protein.
AA Sequence:
MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTSEIFKLE LQNVPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLSVRLARPKADPMA RRRRQEGESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAKEIGSTNRALLPWLLEQRHKHNKACCPLE GVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTPYSAY DPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRKTPSQE GLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKR VIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRR LLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPT PGPPDNTLQETGTFPSS
GeneID:
27037
Remarks:
Gene Accession: NM_022727.4
Add. information Mouse polyclonal antibody raised against a full-length human HTF9C protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 27037

Accessory Products

Proteins and/or Positive Controls

Proteins for TRMT2A / HTF9C (5 products)

Catalog No. Species Pres. Purity   Source  

TRMT2A / HTF9C (transcript variant 2)

TRMT2A / HTF9C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TRMT2A / HTF9C (transcript variant 1)

TRMT2A / HTF9C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

TRMT2A / HTF9C

TRMT2A / HTF9C Human
  Abnova Taiwan Corp.

TRMT2A / HTF9C

TRMT2A / HTF9C Human in vitro transl.
  Abnova Taiwan Corp.

TRMT2A / HTF9C

TRMT2A / HTF9C Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRMT2A / HTF9C (5 products)

Catalog No. Species Pres. Purity   Source  

HTF9C 293T Cell Transient Overexpression Lysate(Denatured)

HTF9C 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HTF9C Lysate

Western Blot: HTF9C Lysate [NBL1-11772] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HTF9C.
  Novus Biologicals Inc.

TRMT2A overexpression lysate

TRMT2A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TRMT2A overexpression lysate

TRMT2A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

TRMT2A overexpression lysate

TRMT2A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn