discontinued

H00079979-B02P TRMT2B antibody

See related secondary antibodies

Search for all "TRMT2B"

Quick Overview

Mouse anti Human TRMT2B

Product Description for TRMT2B

Mouse anti Human TRMT2B.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TRMT2B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CXorf34, tRNA (uracil-5-)-methyltransferase homolog
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GJ1
Immunogen:
TRMT2B (NP_079193.2, 1 a.a. ~ 504 a.a) full-length human protein.
AA Sequence:
MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPL DGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGY RNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRE LTVRTNSQGHTMAIITFHPQKLSQEELHVQKEIVKEFFIRGPGAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPY IFEELLSLKIRISPDAFFQINTAGAEMLYRTVGELTGVNSDTILLDICCGTGVIGLSLAQHTSRVLGIELLEQAVE DARWTAAFNGITNSEFHTGQAEKILPGLLKSKEDGQSIVAVVNPARAGLHYKVIQAIRNFRAIHTLVFVSCKLHGE STRNVIELCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR
GeneID:
79979
Remarks:
Gene Accession: NM_024917
Add. information Mouse polyclonal antibody raised against a full-length human TRMT2B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79979

Accessory Products

Proteins and/or Positive Controls

Proteins for TRMT2B (2 products)

Catalog No. Species Pres. Purity   Source  

TRMT2B

TRMT2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRMT2B

TRMT2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TRMT2B (2 products)

Catalog No. Species Pres. Purity   Source  

CXorf34 293T Cell Transient Overexpression Lysate(Denatured)

CXorf34 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRMT2B overexpression lysate

TRMT2B overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn