discontinued

H00029766-A01 Tropomodulin-3 (TMOD3) antibody

See related secondary antibodies

Search for all "Tropomodulin-3 (TMOD3)"

Quick Overview

Mouse anti Human Tropomodulin-3 (TMOD3)

Product Description for Tropomodulin-3 (TMOD3)

Mouse anti Human Tropomodulin-3 (TMOD3).
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Tropomodulin-3 (TMOD3)

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms U-Tmod, Ubiquitous tropomodulin
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYL9
Immunogen:
TMOD3 (NP_055362, 280 a.a. ~ 353 a.a) partial recombinant protein with GST tag.
AA Sequence:
RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ*
GeneID:
29766
Remarks:
Gene Accession: NM_014547
Add. information Mouse polyclonal antibody raised against a partial recombinant TMOD3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 29766

Accessory Products

Proteins and/or Positive Controls

Proteins for Tropomodulin-3 (TMOD3) (7 products)

Catalog No. Species Pres. Purity   Source  

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Tropomodulin-3 (TMOD3) (1-352, His-tag)

Tropomodulin-3 (TMOD3) Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

Tropomodulin-3 (TMOD3) (1-352, His-tag)

Tropomodulin-3 (TMOD3) Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Tropomodulin-3 (TMOD3) (3 products)

Catalog No. Species Pres. Purity   Source  

TMOD3 293T Cell Transient Overexpression Lysate(Denatured)

TMOD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TMOD3 overexpression lysate

TMOD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Tropomodulin-3 (TMOD3) Lysate

Western Blot: Tropomodulin 3 Lysate [NBL1-17117] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMOD3
  Novus Biologicals Inc.
  • LinkedIn