TA334549 Tropomodulin-3 (TMOD3) antibody

Rabbit Polyclonal Anti-TMOD3 Antibody

See related secondary antibodies

Search for all "Tropomodulin-3 (TMOD3)"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat Tropomodulin-3 (TMOD3)

Product Description for Tropomodulin-3 (TMOD3)

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat Tropomodulin-3 (TMOD3).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tropomodulin-3 (TMOD3)

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms U-Tmod, Ubiquitous tropomodulin
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TMOD3 antibody: synthetic peptide directed towards the middle region of human TMOD3. Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT.
Application WB
Background TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kise pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Tropomodulin-3 (TMOD3) (7 products)

Catalog No. Species Pres. Purity   Source  

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Tropomodulin-3 (TMOD3) (1-352, His-tag)

Tropomodulin-3 (TMOD3) Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €940.00
  OriGene Technologies GmbH

Tropomodulin-3 (TMOD3) (1-352, His-tag)

Tropomodulin-3 (TMOD3) Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €370.00
  OriGene Technologies GmbH

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Tropomodulin-3 (TMOD3)

Tropomodulin-3 (TMOD3) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Tropomodulin-3 (TMOD3) (3 products)

Catalog No. Species Pres. Purity   Source  

TMOD3 293T Cell Transient Overexpression Lysate(Denatured)

TMOD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TMOD3 overexpression lysate

TMOD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Tropomodulin-3 (TMOD3) Lysate

Western Blot: Tropomodulin 3 Lysate [NBL1-17117] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMOD3
  Novus Biologicals Inc.
  • LinkedIn