discontinued

H00029765-B01P Tropomodulin-4 (TMOD4) antibody

See related secondary antibodies

Search for all "Tropomodulin-4 (TMOD4)"

Quick Overview

Mouse anti Human Tropomodulin-4 (TMOD4)

H00029765-B01P

More Views

  • H00029765-B01P

Product Description for Tropomodulin-4 (TMOD4)

Mouse anti Human Tropomodulin-4 (TMOD4).
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Tropomodulin-4 (TMOD4)

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Sk-Tmod, Skeletal muscle tropomodulin
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZQ9
Immunogen:
TMOD4 (AAH17810.1, 1 a.a. ~ 345 a.a) full-length human protein.
AA Sequence:
MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQYLEQQA LEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTLMSNKQYYDALCS GEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPIPMLSELCEAMKANTYVRS FSLVATRSGDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEMEMAT VLEQRPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
GeneID:
29765
Remarks:
Gene Accession: BC017810.1
Add. information Mouse polyclonal antibody raised against a full-length human TMOD4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 29765

Accessory Products

Proteins and/or Positive Controls

Proteins for Tropomodulin-4 (TMOD4) (3 products)

Catalog No. Species Pres. Purity   Source  

Tropomodulin-4 (TMOD4)

Tropomodulin-4 (TMOD4) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomodulin-4 (TMOD4)

Tropomodulin-4 (TMOD4) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomodulin-4 (TMOD4)

Tropomodulin-4 (TMOD4) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Tropomodulin-4 (TMOD4) (3 products)

Catalog No. Species Pres. Purity   Source  

TMOD4 293T Cell Transient Overexpression Lysate(Denatured)

TMOD4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TMOD4 overexpression lysate

TMOD4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Tropomodulin-4 (TMOD4) Lysate

Western Blot: Tropomodulin 4 Lysate [NBL1-17118] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMOD4
  Novus Biologicals Inc.
  • LinkedIn