TA346063 Tropomyosin-1 (TPM1) antibody

Rabbit Polyclonal Anti-TPM1 Antibody

See related secondary antibodies

Search for all "Tropomyosin-1 (TPM1)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat Tropomyosin-1 (TPM1)

Product Description for Tropomyosin-1 (TPM1)

Rabbit anti Human, Mouse, Rat Tropomyosin-1 (TPM1).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tropomyosin-1 (TPM1)

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Alpha-tropomyosin, C15orf13, TMSA, Tropomyosin alpha-1 chain
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09493
Immunogen:
The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED.
GeneID:
7168
Application WB
Background TPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predomint tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predomint tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, altertively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Tropomyosin-1 (TPM1) (15 products)

Catalog No. Species Pres. Purity   Source  

Tropomyosin-1 (TPM1) (transcript variant 5)

Tropomyosin-1 (TPM1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (transcript variant 1)

Tropomyosin-1 (TPM1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (transcript variant 7)

Tropomyosin-1 (TPM1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (transcript variant 3)

Tropomyosin-1 (TPM1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (transcript variant 4)

Tropomyosin-1 (TPM1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (transcript variant 2)

Tropomyosin-1 (TPM1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (transcript variant 5)

Tropomyosin-1 (TPM1) Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Tropomyosin-1 (TPM1) (1-284, His-tag)

Recombinant human TPM1, 1-284aa, His-tagged Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Tropomyosin-1 (TPM1) (1-284, His-tag)

Recombinant human TPM1, 1-284aa, His-tagged Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Tropomyosin-1 (TPM1)

Tropomyosin-1 (TPM1) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomyosin-1 (TPM1)

Tropomyosin-1 (TPM1) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomyosin-1 (TPM1)

Tropomyosin-1 (TPM1) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomyosin-1 (TPM1)

Tropomyosin-1 (TPM1) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tropomyosin-1 (TPM1)

Tropomyosin-1 (TPM1) Human Purified
  Novus Biologicals Inc.

Tropomyosin-1 (TPM1)

Tropomyosin-1 (TPM1) Human Purified
  Novus Biologicals Inc.

Positive controls for Tropomyosin-1 (TPM1) (1 products)

Catalog No. Species Pres. Purity   Source  

Tropomyosin-1 Lysate

Western Blot: Tropomyosin-1 Lysate [NBL1-17219] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TPM1
  Novus Biologicals Inc.
  • LinkedIn