NBP1-57301 TROVE2 antibody

See related secondary antibodies

Search for all "TROVE2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse TROVE2


Product Description for TROVE2

Rabbit anti Canine, Human, Mouse TROVE2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TROVE2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Can, Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TROVE2 (TROVE domain family, member 2) The peptide sequence was selected from the N terminal of TROVE2 . Peptide sequence QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR.
Background TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6738

Accessory Products

  • LinkedIn