
NBP1-57301 TROVE2 antibody

See related secondary antibodies

Search for all "TROVE2"

50 µg / €440.00

Quick Overview

Rabbit anti Canine, Human, Mouse TROVE2


Product Description for TROVE2

Rabbit anti Canine, Human, Mouse TROVE2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TROVE2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Can, Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TROVE2 (TROVE domain family, member 2) The peptide sequence was selected from the N terminal of TROVE2 . Peptide sequence QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR.
Background TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6738

Accessory Products

  • LinkedIn