discontinued

NBP1-57302 TROVE2 antibody

See related secondary antibodies

Search for all "TROVE2"

0.1 mg / €330.00

Quick Overview

Rabbit anti Human TROVE2

Product Description for TROVE2

Rabbit anti Human TROVE2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TROVE2

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5LJA0
Immunogen:
Synthetic peptides corresponding to TROVE2 (TROVE domain family, member 2) The peptide sequence was selected from the N terminal of TROVE2 . Peptide sequence QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS.
GeneID:
6738
Background As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 6738

Accessory Products

  • LinkedIn