TA334766 Tryptophan 5-hydroxylase 2 (TPH2) antibody

Rabbit Polyclonal Anti-TPH2 Antibody

See related secondary antibodies

Search for all "Tryptophan 5-hydroxylase 2 (TPH2)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Tryptophan 5-hydroxylase 2 (TPH2)

Product Description for Tryptophan 5-hydroxylase 2 (TPH2)

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Tryptophan 5-hydroxylase 2 (TPH2).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tryptophan 5-hydroxylase 2 (TPH2)

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms NTPH, Neuronal tryptophan hydroxylase, Tryptophan 5-monooxygenase 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2. Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS.
Application WB
Background Tryptophan hydroxylase (TPH; EC is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintence of vascular tone and gut motility.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Tryptophan 5-hydroxylase 2 (TPH2) (1 products)

Catalog No. Species Pres. Purity   Source  

Tryptophan 5-hydroxylase 2 (TPH2)

Tryptophan 5-hydroxylase 2 (TPH2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn