NBP1-91727 TSC21 antibody

See related secondary antibodies

Search for all "TSC21"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TSC21

Product Description for TSC21

Rabbit anti Human TSC21.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TSC21

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LM6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLP
GeneID:
200523
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 200523

Accessory Products

Proteins and/or Positive Controls

Proteins for TSC21 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 2 open reading frame 51 (C2orf51)

Chromosome 2 open reading frame 51 (C2orf51) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TSC21 (2 products)

Catalog No. Species Pres. Purity   Source  

C2orf51 Lysate

Western Blot: TSC21 Lysate [NBL1-08418] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TSC21 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

TEX37 overexpression lysate

TEX37 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn