discontinued

NBP1-91727 TSC21 antibody

See related secondary antibodies

Search for all "TSC21"

Quick Overview

Rabbit anti Human TSC21

Product Description for TSC21

Rabbit anti Human TSC21.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TSC21

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LM6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLP
GeneID:
200523
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 200523

Accessory Products

Proteins and/or Positive Controls

Proteins for TSC21 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 2 open reading frame 51 (C2orf51)

Chromosome 2 open reading frame 51 (C2orf51) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TSC21 (2 products)

Catalog No. Species Pres. Purity   Source  

C2orf51 Lysate

Western Blot: TSC21 Lysate [NBL1-08418] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TSC21 Protein
  Novus Biologicals Inc.

TEX37 overexpression lysate

TEX37 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn