discontinued

NBP1-53167 TSH Receptor antibody

See related secondary antibodies

Search for all "TSH Receptor"

0.1 mg / €360.00

Quick Overview

Rabbit anti Human TSH Receptor

Product Description for TSH Receptor

Rabbit anti Human TSH Receptor.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TSH Receptor

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms LGR3, MGC75129, hTSHR-I
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GT6
Immunogen:
Synthetic peptides corresponding to TSHR(thyroid stimulating hormone receptor) The peptide sequence was selected from the N terminal of TSHR. Peptide sequence CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR.
Background TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified

Accessory Products

  • LinkedIn