NBP1-53168 TSH Receptor antibody

See related secondary antibodies

Search for all "TSH Receptor"

50 µg / €390.00

Quick Overview

Rabbit anti Human TSH Receptor

Product Description for TSH Receptor

Rabbit anti Human TSH Receptor.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TSH Receptor

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LGR3, MGC75129, hTSHR-I
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TSHR(thyroid stimulating hormone receptor) The peptide sequence was selected from the C terminal of TSHR. Peptide sequence KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS.
Background TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn