NBP1-53168 TSH Receptor antibody

See related secondary antibodies

Search for all "TSH Receptor"

Quick Overview

Rabbit anti Human TSH Receptor

Product Description for TSH Receptor

Rabbit anti Human TSH Receptor.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TSH Receptor

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LGR3, MGC75129, hTSHR-I
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TSHR(thyroid stimulating hormone receptor) The peptide sequence was selected from the C terminal of TSHR. Peptide sequence KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS.
Background TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn