H00203062-B01P TSNARE1 antibody

See related secondary antibodies

Search for all "TSNARE1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TSNARE1

H00203062-B01P

Product Description for TSNARE1

Mouse anti Human TSNARE1.
Product is tested for Western blot / Immunoblot.

Properties for TSNARE1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ31164, MGC142116
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96NA8
Immunogen:
TSNARE1 (ADR83212.1, 1 a.a. ~ 514 a.a) full-length human protein.
AA Sequence:
MSYGSIARGGGLGSRGPFGGPSRQGCQPLECARCWTEYGIRHFPCPSPESKLQNRCVGKDGEGDLGPAGTPIVPRA RKRGPGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTRAKKRKPNFCPQETEVLVSKVSKHHQLLFGTGL LKAEPTRRYRVWSRILQAVNALGYCRRDVVDLKHKWRDLRAVVRRKLGDLRKAAHGPSPGSGKPQALALTPVEQVV AKTFSCQALPSEGFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQE TNKTIAASASSVKQMAELLRSSCPQERLQQERPQLDRLKTQLSDAIQCYGVVQKKIAEKSRALLPMAQRGSKQQSP QAPFAELADDEKVFNGSDNMWQGQEQALLPDITEEDLEAIRLREEAILQMESNLLDVNQIIKDLASMVSEQGEAVD SIEASLEAASSHAEAARQLLAGASRHQLQRHKIKCCFLSAGVTALLVIIIIIATSVRK
GeneID:
203062
Add. information Mouse polyclonal antibody raised against a full-length human TSNARE1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TSNARE1 (1 products)

Catalog No. Species Pres. Purity   Source  

TSNARE1 overexpression lysate

TSNARE1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn