NBP1-93578 TSPYL5 antibody

See related secondary antibodies

Search for all "TSPYL5"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TSPYL5

Product Description for TSPYL5

Rabbit anti Human TSPYL5.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TSPYL5

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86VY4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSFFGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARV
GeneID:
85453
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 85453

Accessory Products

Proteins and/or Positive Controls

Proteins for TSPYL5 (1 products)

Catalog No. Species Pres. Purity   Source  

TSPY-like 5 (TSPYL5)

TSPY-like 5 (TSPYL5) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TSPYL5 (1 products)

Catalog No. Species Pres. Purity   Source  

TSPYL5 overexpression lysate

TSPYL5 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn