discontinued

H00081629-M01 TSSK3 antibody

See related secondary antibodies

Search for all "TSSK3"

0.1 mg / €370.00

Quick Overview

Mouse anti Human TSSK3 6G3

Product Description for TSSK3

Mouse anti Human TSSK3 6G3.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TSSK3

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 6G3
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
TSSK3 (AAH35354, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEM LESADGKICLVMELAEGGDVFDCVLNGGPLPESR
Remarks:
Gene Accession: BC035354
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant TSSK3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Ti
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn