discontinued

H00083983-D01 TSSK6 / SSTK antibody

See related secondary antibodies

Search for all "TSSK6 / SSTK"

Quick Overview

Rabbit anti Human TSSK6 / SSTK

H00083983-D01

More Views

  • H00083983-D01

Product Description for TSSK6 / SSTK

Rabbit anti Human TSSK6 / SSTK.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation, Western blot / Immunoblot.

Properties for TSSK6 / SSTK

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CT72, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase, TSK-6, TSSK-6, Testis-specific kinase 6, Testis-specific serine/threonine-protein kinase 6
Presentation Serum
Reactivity Hu
Applications E(detection), IP, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXA6
Immunogen:
TSSK6 (NP_114426.1, 1 a.a. ~ 273 a.a) full-length human protein.
AA Sequence:
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVF EFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKL TDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGV LYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
GeneID:
83983
Remarks:
Gene Accession: NM_032037.2
Add. information Rabbit polyclonal antibody raised against a full-length human TSSK6 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP,WB-Ti
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 83983

Accessory Products

Proteins and/or Positive Controls

Proteins for TSSK6 / SSTK (7 products)

Catalog No. Species Pres. Purity   Source  

TSSK6 / SSTK (1-273, His-tag)

TSSK6 / SSTK Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

TSSK6 / SSTK (1-273, His-tag)

TSSK6 / SSTK Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

TSSK6 / SSTK

TSSK6 / SSTK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TSSK6 / SSTK

TSSK6 / SSTK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TSSK6 / SSTK

TSSK6 / SSTK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TSSK6 / SSTK

TSSK6 / SSTK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TSSK6 / SSTK

TSSK6 / SSTK Human
  Abnova Taiwan Corp.

Positive controls for TSSK6 / SSTK (2 products)

Catalog No. Species Pres. Purity   Source  

TSSK6 293T Cell Transient Overexpression Lysate(Denatured)

TSSK6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TSSK6 Lysate

Western Blot: TSSK6 Lysate [NBL1-17395] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TSSK6
  Novus Biologicals Inc.
  • LinkedIn