
NBP1-56424 TTC12 antibody

See related secondary antibodies

Search for all "TTC12"

Quick Overview

Rabbit anti Human, Rat TTC12

Product Description for TTC12

Rabbit anti Human, Rat TTC12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TTC12

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Tetratricopeptide repeat domain 12 isoform CRA_a
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TTC12(tetratricopeptide repeat domain 12) The peptide sequence was selected from the C terminal of TTC12. Peptide sequence MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK.
Background TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn