NBP1-56424 TTC12 antibody

See related secondary antibodies

Search for all "TTC12"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat TTC12

Product Description for TTC12

Rabbit anti Human, Rat TTC12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TTC12

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Tetratricopeptide repeat domain 12 isoform CRA_a
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TTC12(tetratricopeptide repeat domain 12) The peptide sequence was selected from the C terminal of TTC12. Peptide sequence MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK.
Background TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn