discontinued

H00064927-B01P TTC23 antibody

See related secondary antibodies

Search for all "TTC23"

Quick Overview

Mouse anti Human TTC23

H00064927-B01P

More Views

  • H00064927-B01P

Product Description for TTC23

Mouse anti Human TTC23.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TTC23

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Cervical cancer proto-oncogene 8 protein, HCC-8, HCC8, TPR repeat protein 23, Tetratricopeptide repeat protein 23
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5W5X9
Immunogen:
TTC23 (AAH15728.1, 1 a.a. ~ 393 a.a) full-length human protein.
AA Sequence:
MQESQETHISNHLDEVVAAVSITHRKKFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHEYKQAVHELVRCVALTR ICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKARQILANSIVPPYSENTDVFKFSIELFHTMGRALLSLQK FKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSRECV PILRELAGVEQALGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAVASGRHEHHDVAEQYFQESMAHLKD SEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLK KGDLSFLLSATLP
GeneID:
64927
Remarks:
Gene Accession: BC015728
Add. information Mouse polyclonal antibody raised against a full-length human TTC23 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 64927

Accessory Products

Proteins and/or Positive Controls

Proteins for TTC23 (2 products)

Catalog No. Species Pres. Purity   Source  

TTC23

TTC23 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TTC23

TTC23 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TTC23 (1 products)

Catalog No. Species Pres. Purity   Source  

TTC23 293T Cell Transient Overexpression Lysate(Denatured)

TTC23 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn