discontinued

H00092104-B01 TTC30A antibody

See related secondary antibodies

Search for all "TTC30A"

Quick Overview

Mouse anti Human TTC30A

Product Description for TTC30A

Mouse anti Human TTC30A.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TTC30A

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms FLJ13946, TPR repeat protein 30A, Tetratricopeptide repeat protein 30A
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86WT1
Immunogen:
TTC30A (AAH42848, 1 a.a. ~ 665 a.a) full-length human protein.
AA Sequence:
MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHP ELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDN ETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVG MTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTE GFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDALITCQTAPEEAFIKLD GLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCND HDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLS YDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKRLGTDTWYYAKRCFLSLLENMSKHMIVIHDSV IQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEIIGWNK
GeneID:
92104
Remarks:
Gene Accession: BC042848
Add. information Mouse polyclonal antibody raised against a full-length human TTC30A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 92104

Accessory Products

Proteins and/or Positive Controls

Proteins for TTC30A (4 products)

Catalog No. Species Pres. Purity   Source  

TTC30A

TTC30A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TTC30A

TTC30A Human
  Abnova Taiwan Corp.

TTC30A

TTC30A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

TTC30A

TTC30A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for TTC30A (3 products)

Catalog No. Species Pres. Purity   Source  

FLJ13946 Lysate

Western Blot: FLJ13946 Lysate [NBL1-17405] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TTC30A
  Novus Biologicals Inc.

TTC30A 293T Cell Transient Overexpression Lysate(Denatured)

TTC30A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TTC30A overexpression lysate

TTC30A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn