discontinued

H00007268-M09 TTC4 antibody

See related secondary antibodies

Search for all "TTC4"

Quick Overview

Mouse anti Human TTC4 1E10

Product Description for TTC4

Mouse anti Human TTC4 1E10.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TTC4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms My044, TPR repeat protein 4, Tetratricopeptide repeat protein 4
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1E10
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O95801
Immunogen:
TTC4 (NP_004614, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMTRAPSEIDPRENPDLACLQSIIFDEERSPE EQAKTYKDEGNDYFKEKDYKKAVI*
GeneID:
7268
Remarks:
Gene Accession: NM_004623
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant TTC4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7268

Accessory Products

Proteins and/or Positive Controls

Proteins for TTC4 (4 products)

Catalog No. Species Pres. Purity   Source  

TTC4

TTC4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TTC4

TTC4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TTC4

TTC4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TTC4

TTC4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TTC4 (4 products)

Catalog No. Species Pres. Purity   Source  

TTC4 293T Cell Transient Overexpression Lysate(Denatured)

TTC4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TTC4 293T Cell Transient Overexpression Lysate(Denatured)

TTC4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TTC4 Lysate

Western Blot: TTC4 Lysate [NBL1-17411] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TTC4
  Novus Biologicals Inc.

TTC4 overexpression lysate

TTC4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn