TA346808 TTC7A antibody

Rabbit Polyclonal Anti-TTC7A Antibody

See related secondary antibodies

Search for all "TTC7A"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TTC7A

Product Description for TTC7A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TTC7A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TTC7A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA1140, TTC7, Tetratricopeptide repeat protein 7A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULT0
Immunogen:
The immunogen for Anti-TTC7A antibody is: synthetic peptide directed towards the N-terminal region of Human TTC7A. Synthetic peptide located within the following region: EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPS.
GeneID:
57217
Application WB
Background This gene encodes a protein containing tetratricopeptide repeats. Mutations in this gene disrupt intestinal development and can cause early onset inflammatory bowel disease and intestinal atresia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TTC7A (1 products)

Catalog No. Species Pres. Purity   Source  

TTC7A overexpression lysate

TTC7A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn