H00023508-B01P TTC9 antibody

See related secondary antibodies

Search for all "TTC9"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TTC9

H00023508-B01P

Product Description for TTC9

Mouse anti Human TTC9.
Product is tested for Western blot / Immunoblot.

Properties for TTC9

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms KIAA0227, TTC9A
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92623
Immunogen:
TTC9 (AAI60145.1, 1 a.a. ~ 222 a.a) full-length human protein.
AA Sequence:
MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEFKSQGAQCYKDKKFREA IGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQAELVNYERVKEY CLKVLKKEGENFKALYRSGVAFYHLGDYDKALYYLKEARTQQPTDTNVIRYIQLTEMKLSRCSQREKEAM
GeneID:
23508
Add. information Mouse polyclonal antibody raised against a full-length human TTC9 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for TTC9 (1 products)

Catalog No. Species Pres. Purity   Source  

Tetratricopeptide repeat domain 9 (TTC9)

Tetratricopeptide repeat domain 9 (TTC9) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn