NBP1-93934 TTMP / C3orf52 antibody

See related secondary antibodies

Search for all "TTMP / C3orf52"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TTMP / C3orf52

Product Description for TTMP / C3orf52

Rabbit anti Human TTMP / C3orf52.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TTMP / C3orf52

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TPA-induced transmembrane protein
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5BVD1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK
GeneID:
79669
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 79669

Accessory Products

Proteins and/or Positive Controls

Positive controls for TTMP / C3orf52 (1 products)

Catalog No. Species Pres. Purity   Source  

C3orf52 overexpression lysate

C3orf52 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn