H00007273-M07A TTN antibody

See related secondary antibodies

Search for all "TTN"

0.2 ml / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TTN 2F12

H00007273-M07A

Product Description for TTN

Mouse anti Human TTN 2F12.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TTN

Product Category Primary Antibodies
Quantity 0.2 ml
Synonyms CMD1G, CMH9, CMPD4, CONNECTIN, DKFZp451N061, EOMFC, FLJ26020, FLJ26409, FLJ32040, FLJ34413, FLJ39564, FLJ43066, HMERF, LGMD2J, TMD
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2F12
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4ZG20
Immunogen:
TTN (AAH58824, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSG RYSLKATNGSGQATSTAELLVKAETAPPNFVQRL
GeneID:
7273
Add. information Mouse monoclonal antibody raised against a partial recombinant TTN.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In ascites fluid.
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn