discontinued

H00051807-D01P TUBA8 / TUBAL2 antibody

See related secondary antibodies

Search for all "TUBA8 / TUBAL2"

Quick Overview

Rabbit anti Human TUBA8 / TUBAL2

H00051807-D01P

More Views

  • H00051807-D01P

Product Description for TUBA8 / TUBAL2

Rabbit anti Human TUBA8 / TUBAL2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TUBA8 / TUBAL2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Alpha-tubulin 8, Tubulin alpha chain-like 2, Tubulin alpha-8 chain
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NY65
Immunogen:
TUBA8 (NP_061816.1, 1 a.a. ~ 449 a.a) full-length human protein.
AA Sequence:
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGKHVPRAVMIDLEPTVVD EVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDACSGLQGFLIFHSFGGGTGSGFTSL LMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLN RLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNSQMVK CDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSN TTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSFEEENEGEEF
GeneID:
1962
Remarks:
Gene Accession: NM_018943.1
Add. information Rabbit polyclonal antibody raised against a full-length human TUBA8 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51807

Accessory Products

Proteins and/or Positive Controls

Proteins for TUBA8 / TUBAL2 (5 products)

Catalog No. Species Pres. Purity   Source  

TUBA8 / TUBAL2

TUBA8 / TUBAL2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TUBA8 / TUBAL2

TUBA8 / TUBAL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBA8 / TUBAL2

TUBA8 / TUBAL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBA8 / TUBAL2

TUBA8 / TUBAL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBA8 / TUBAL2

TUBA8 / TUBAL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TUBA8 / TUBAL2 (1 products)

Catalog No. Species Pres. Purity   Source  

Tubulin alpha-8 Lysate

Western Blot: Tubulin alpha-8 Lysate [NBL1-17434] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TUBA8
  Novus Biologicals Inc.
  • LinkedIn