discontinued

H00007280-M05 TUBB2A antibody

See related secondary antibodies

Search for all "TUBB2A"

Quick Overview

Mouse anti Human TUBB2A 3F9

H00007280-M05

More Views

  • H00007280-M05
  • H00007280-M05

Product Description for TUBB2A

Mouse anti Human TUBB2A 3F9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for TUBB2A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms TUBB2, Tubulin beta-2A chain
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 3F9
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13885
Immunogen:
TUBB2A (AAH01194, 1 a.a. ~ 446 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSV RSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLI SKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHL VSATMSGVTTCLRFPGQLNADLRKLAV
GeneID:
7280
Remarks:
Gene Accession: BC001194
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7280

Accessory Products

Proteins and/or Positive Controls

Proteins for TUBB2A (7 products)

Catalog No. Species Pres. Purity   Source  

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBB2A (2 products)

Catalog No. Species Pres. Purity   Source  

beta II Tubulin A Lysate

Western Blot: beta II Tubulin A Lysate [NBL1-17437]
  Novus Biologicals Inc.

TUBB (Tubulin beta chain) Lysate(Denatured)

TUBB (Tubulin beta chain) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn