TA344291 TUBB2A antibody

Rabbit Polyclonal Anti-Tubb2a Antibody - C-terminal region

See related secondary antibodies

Search for all "TUBB2A"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse TUBB2A

Product Description for TUBB2A

Rabbit anti Human, Mouse TUBB2A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TUBB2A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TUBB2, Tubulin beta-2A chain
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13885
Immunogen:
The immunogen for Anti-Tubb2a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tubb2a. Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE.
GeneID:
7280
Application WB
Background Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TUBB2A (7 products)

Catalog No. Species Pres. Purity   Source  

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBB2A (2 products)

Catalog No. Species Pres. Purity   Source  

beta II Tubulin A Lysate

Western Blot: beta II Tubulin A Lysate [NBL1-17437]
  Novus Biologicals Inc.

TUBB (Tubulin beta chain) Lysate(Denatured)

TUBB (Tubulin beta chain) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn