TA345669 TUBB2A antibody

Rabbit Polyclonal Anti-TUBB2A Antibody

See related secondary antibodies

Search for all "TUBB2A"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish TUBB2A

Product Description for TUBB2A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish TUBB2A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TUBB2A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TUBB2, Tubulin beta-2A chain
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV.
Application WB
Background TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TUBB2A (7 products)

Catalog No. Species Pres. Purity   Source  


TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TUBB2A Human Purified
  Abnova Taiwan Corp.


TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBB2A (2 products)

Catalog No. Species Pres. Purity   Source  

beta II Tubulin A Lysate

Western Blot: beta II Tubulin A Lysate [NBL1-17437]
  Novus Biologicals Inc.

TUBB (Tubulin beta chain) Lysate(Denatured)

TUBB (Tubulin beta chain) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn