discontinued

H00010383-M02 TUBB2C antibody

See related secondary antibodies

Search for all "TUBB2C"

Quick Overview

Mouse anti Human TUBB2C 1G3

H00010383-M02

More Views

  • H00010383-M02
  • H00010383-M02

Product Description for TUBB2C

Mouse anti Human TUBB2C 1G3.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TUBB2C

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Tubulin beta-2 chain, Tubulin beta-2C chain
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 1G3
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P68371
Immunogen:
TUBB2 (AAH01911, 1 a.a. ~ 446 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSV RSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLI SKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHL VSATMSGVTTCLRFPGQLNADLRKLAV
GeneID:
10383
Remarks:
Gene Accession: BC001911
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant TUBB2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10383

Accessory Products

Proteins and/or Positive Controls

Proteins for TUBB2C (5 products)

Catalog No. Species Pres. Purity   Source  

TUBB2C

TUBB2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2C

TUBB2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2C

TUBB2C Human Purified
  Abnova Taiwan Corp.

TUBB2C

TUBB2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2C

TUBB2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBB2C (1 products)

Catalog No. Species Pres. Purity   Source  

Tubulin Beta 2C Lysate

Western Blot: Tubulin Beta 2C Lysate [NBL1-17439] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TUBB2C
  Novus Biologicals Inc.
  • LinkedIn