discontinued

H00007291-B01P TWIST1 antibody

See related secondary antibodies

Search for all "TWIST1"

Quick Overview

Mouse anti Human TWIST1

H00007291-B01P

More Views

  • H00007291-B01P

Product Description for TWIST1

Mouse anti Human TWIST1.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TWIST1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BHLHA38, Class A basic helix-loop-helix protein 38, TWIST, Twist-related protein 1
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15672
Immunogen:
TWIST1 (NP_000465.1, 1 a.a. ~ 202 a.a) full-length human protein.
AA Sequence:
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGK KSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLA ARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
GeneID:
7291
Remarks:
Gene Accession: NM_000474.3
Add. information Mouse polyclonal antibody raised against a full-length human TWIST1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7291

Accessory Products

Proteins and/or Positive Controls

Proteins for TWIST1 (8 products)

Catalog No. Species Pres. Purity   Source  

TWIST1

TWIST1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human Purified
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TWIST1 (2 products)

Catalog No. Species Pres. Purity   Source  

TWIST1 293T Cell Transient Overexpression Lysate(Denatured)

TWIST1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TWIST1 overexpression lysate

TWIST1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn