discontinued

H00007291-M03 TWIST1 antibody

See related secondary antibodies

Search for all "TWIST1"

Quick Overview

Mouse anti Human TWIST1 2F8

H00007291-M03

More Views

  • H00007291-M03

Product Description for TWIST1

Mouse anti Human TWIST1 2F8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TWIST1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BHLHA38, Class A basic helix-loop-helix protein 38, TWIST, Twist-related protein 1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2F8
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15672
Immunogen:
TWIST1 (NP_000465, 100 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASC SYVAHERLSYAFSVWRMEGAWSMSASH*
GeneID:
7291
Remarks:
Gene Accession: NM_000474
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant TWIST1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7291

Accessory Products

Proteins and/or Positive Controls

Proteins for TWIST1 (8 products)

Catalog No. Species Pres. Purity   Source  

TWIST1

TWIST1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human Purified
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TWIST1

TWIST1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TWIST1 (2 products)

Catalog No. Species Pres. Purity   Source  

TWIST1 293T Cell Transient Overexpression Lysate(Denatured)

TWIST1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TWIST1 overexpression lysate

TWIST1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn