TA335179 TWIST1 antibody

Rabbit Polyclonal Anti-TWIST1 Antibody

See related secondary antibodies

Search for all "TWIST1"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat, Zebrafish TWIST1


More Views

  • TA335179
  • TA335179

Product Description for TWIST1

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat, Zebrafish TWIST1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TWIST1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BHLHA38, Class A basic helix-loop-helix protein 38, TWIST, Twist-related protein 1
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TWIST1 antibody: synthetic peptide directed towards the C terminal of human TWIST1. Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW.
Application WB
Background Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determition and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mR is in placental tissue; in adults, mesodermally derived tissues express this mR preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TWIST1 (8 products)

Catalog No. Species Pres. Purity   Source  


TWIST1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TWIST1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TWIST1 Human Purified
  Abnova Taiwan Corp.


TWIST1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TWIST1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TWIST1 (2 products)

Catalog No. Species Pres. Purity   Source  

TWIST1 293T Cell Transient Overexpression Lysate(Denatured)

TWIST1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TWIST1 overexpression lysate

TWIST1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn