discontinued

H00117581-B01 TWIST2 antibody

See related secondary antibodies

Search for all "TWIST2"

Quick Overview

Mouse anti Human TWIST2

Product Description for TWIST2

Mouse anti Human TWIST2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TWIST2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BHLHA39, Class A basic helix-loop-helix protein 39, DERMO1, Dermis-expressed protein 1, Dermo-1, Twist-related protein 2
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVJ9
Immunogen:
TWIST2 (NP_476527.1, 1 a.a. ~ 160 a.a) full-length human protein.
AA Sequence:
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRER QRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEG AWSMSASH
GeneID:
117581
Remarks:
Gene Accession: NM_057179.1
Add. information Mouse polyclonal antibody raised against a full-length human TWIST2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 117581

Accessory Products

Proteins and/or Positive Controls

Proteins for TWIST2 (5 products)

Catalog No. Species Pres. Purity   Source  

TWIST2

TWIST2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TWIST2

TWIST2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST2

TWIST2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST2

TWIST2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TWIST2

TWIST2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TWIST2 (1 products)

Catalog No. Species Pres. Purity   Source  

Twist2 Lysate

Western Blot: Twist2 Lysate [NBL1-17460] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TWIST2
  Novus Biologicals Inc.
  • LinkedIn