discontinued

H00117581-M01 TWIST2 antibody

See related secondary antibodies

Search for all "TWIST2"

Quick Overview

Mouse anti Human TWIST2 3C8

H00117581-M01

More Views

  • H00117581-M01

Product Description for TWIST2

Mouse anti Human TWIST2 3C8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for TWIST2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BHLHA39, Class A basic helix-loop-helix protein 39, DERMO1, Dermis-expressed protein 1, Dermo-1, Twist-related protein 2
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3C8
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVJ9
Immunogen:
TWIST2 (AAH33168, 1 a.a. ~ 161 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRER QRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEG SWSMSASH*
GeneID:
117581
Remarks:
Gene Accession: BC033168
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant TWIST2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 117581

Accessory Products

Proteins and/or Positive Controls

Proteins for TWIST2 (5 products)

Catalog No. Species Pres. Purity   Source  

TWIST2

TWIST2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TWIST2

TWIST2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST2

TWIST2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TWIST2

TWIST2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TWIST2

TWIST2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TWIST2 (1 products)

Catalog No. Species Pres. Purity   Source  

Twist2 Lysate

Western Blot: Twist2 Lysate [NBL1-17460] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TWIST2
  Novus Biologicals Inc.
  • LinkedIn