discontinued

H00081567-B01P TXNDC5 / TLP46 antibody

See related secondary antibodies

Search for all "TXNDC5 / TLP46"

Quick Overview

Mouse anti Human TXNDC5 / TLP46

H00081567-B01P

More Views

  • H00081567-B01P
  • H00081567-B01P

Product Description for TXNDC5 / TLP46

Mouse anti Human TXNDC5 / TLP46.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for TXNDC5 / TLP46

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ERp46, Endoplasmic reticulum resident protein 46, Thioredoxin domain-containing protein 5, Thioredoxin-like protein p46
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, P, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBS9
Immunogen:
TXNDC5 (AAH52310.1, 1 a.a. ~ 360 a.a) full-length human protein.
AA Sequence:
MTQSVDSNRGNRNEKRCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEA VKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALA PTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKI AEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL
GeneID:
81567
Remarks:
Gene Accession: BC052310.1
Add. information Mouse polyclonal antibody raised against a full-length human TXNDC5 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,IHC-P,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 81567

Accessory Products

Proteins and/or Positive Controls

Proteins for TXNDC5 / TLP46 (3 products)

Catalog No. Species Pres. Purity   Source  

TXNDC5 / TLP46 (transcript variant 1)

TXNDC5 / TLP46 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TXNDC5 / TLP46

TXNDC5 / TLP46 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TXNDC5 / TLP46

TXNDC5 / TLP46 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TXNDC5 / TLP46 (2 products)

Catalog No. Species Pres. Purity   Source  

TXNDC5 293T Cell Transient Overexpression Lysate(Denatured)

TXNDC5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TXNDC5 Lysate

TXNDC5 Lysate
  Novus Biologicals Inc.
  • LinkedIn