discontinued

H00115861-D01P TXNL6 / NXNL1 antibody

See related secondary antibodies

Search for all "TXNL6 / NXNL1"

Quick Overview

Rabbit anti Human TXNL6 / NXNL1

Product Description for TXNL6 / NXNL1

Rabbit anti Human TXNL6 / NXNL1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TXNL6 / NXNL1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Nucleoredoxin-like protein 1, Thioredoxin-like protein 6
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96CM4
Immunogen:
NXNL1 (NP_612463.1, 1 a.a. ~ 212 a.a) full-length human protein.
AA Sequence:
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALV YVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANW QEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
GeneID:
115861
Remarks:
Gene Accession: NM_138454.1
Add. information Rabbit polyclonal antibody raised against a full-length human NXNL1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 115861

Accessory Products

Proteins and/or Positive Controls

Proteins for TXNL6 / NXNL1 (5 products)

Catalog No. Species Pres. Purity   Source  

TXNL6 / NXNL1

TXNL6 / NXNL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TXNL6 / NXNL1

TXNL6 / NXNL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TXNL6 / NXNL1

TXNL6 / NXNL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TXNL6 / NXNL1

TXNL6 / NXNL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TXNL6 / NXNL1

TXNL6 / NXNL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TXNL6 / NXNL1 (2 products)

Catalog No. Species Pres. Purity   Source  

NXNL1 overexpression lysate

NXNL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TXNL6 293T Cell Transient Overexpression Lysate(Denatured)

TXNL6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn