discontinued

NBP1-74202 TYRP1 antibody

See related secondary antibodies

Search for all "TYRP1"

50 µg / €390.00

Quick Overview

Rabbit anti Rat TYRP1

NBP1-74202

Product Description for TYRP1

Rabbit anti Rat TYRP1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TYRP1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q67KH3
Immunogen:
Synthetic peptides corresponding to the C terminal of Tyrp1. Immunizing peptide sequence AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN.
GeneID:
2981820
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Reconstitute with 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 2981820

Accessory Products

  • LinkedIn