discontinued

H00055253-B01 TYW1 / RSAFD1 antibody

See related secondary antibodies

Search for all "TYW1 / RSAFD1"

Quick Overview

Mouse anti Human TYW1 / RSAFD1

H00055253-B01

More Views

  • H00055253-B01

Product Description for TYW1 / RSAFD1

Mouse anti Human TYW1 / RSAFD1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TYW1 / RSAFD1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Radical S-adenosyl methionine and flavodoxin domain-containing protein 1, tRNA wybutosine-synthesizing protein 1 homolog, tRNA-yW-synthesizing protein
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NV66
Immunogen:
RSAFD1 (AAH51888.1, 1 a.a. ~ 384 a.a) full-length human protein.
AA Sequence:
MDPSADTWDLFSPLISLWINRFYIYLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQDLMTNGYVSLQEKDIFV SGVKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFC KWLEEASIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEAD FRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEFGGED HQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQVHAPRERRLLQTH ILWN
GeneID:
55253
Remarks:
Gene Accession: BC051888.1
Add. information Mouse polyclonal antibody raised against a full-length human RSAFD1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 55253

Accessory Products

Proteins and/or Positive Controls

Proteins for TYW1 / RSAFD1 (2 products)

Catalog No. Species Pres. Purity   Source  

TYW1 / RSAFD1

TYW1 / RSAFD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TYW1 / RSAFD1

TYW1 / RSAFD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TYW1 / RSAFD1 (2 products)

Catalog No. Species Pres. Purity   Source  

TYW1 293T Cell Transient Overexpression Lysate(Denatured)

TYW1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TYW1 overexpression lysate

TYW1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn