NBP1-57374 U2AF35 antibody

See related secondary antibodies

Search for all "U2AF35"

50 µg / €390.00

Quick Overview

Rabbit anti Drosophila, Human, Mouse, Rat U2AF35

Product Description for U2AF35

Rabbit anti Drosophila, Human, Mouse, Rat U2AF35.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for U2AF35

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp313J1712, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Presentation Aff - Purified
Reactivity Dros, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to U2AF1(U2 small nuclear RNA auxiliary factor 1) The peptide sequence was selected from the N terminal of U2AF1. Peptide sequence MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN.
Background This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which pl
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 7307

Accessory Products

  • LinkedIn