discontinued

NBP1-57374 U2AF35 antibody

See related secondary antibodies

Search for all "U2AF35"

Quick Overview

Rabbit anti Drosophila, Human, Mouse, Rat U2AF35

Product Description for U2AF35

Rabbit anti Drosophila, Human, Mouse, Rat U2AF35.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for U2AF35

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp313J1712, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Presentation Aff - Purified
Reactivity Dros, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q701P4
Immunogen:
Synthetic peptides corresponding to U2AF1(U2 small nuclear RNA auxiliary factor 1) The peptide sequence was selected from the N terminal of U2AF1. Peptide sequence MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN.
GeneID:
102724594
Background This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which pl
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 7307

Accessory Products

  • LinkedIn