discontinued

H00009040-M01 UBE2M antibody

See related secondary antibodies

Search for all "UBE2M"

Quick Overview

Mouse anti Human UBE2M 3C4

H00009040-M01

More Views

  • H00009040-M01
  • H00009040-M01

Product Description for UBE2M

Mouse anti Human UBE2M 3C4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for UBE2M

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms NEDD8 carrier protein, NEDD8 protein ligase, NEDD8-conjugating enzyme Ubc12, UBC12, Ubiquitin-conjugating enzyme E2 M
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 3C4
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P61081
Immunogen:
UBE2M (AAH58924, 1 a.a. ~ 184 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKF VFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEV LQNNRRLFEQNVQRSMRGGYIGSTYFERCLK*
GeneID:
9040
Remarks:
Gene Accession: BC058924
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant UBE2M.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9040

Accessory Products

Proteins and/or Positive Controls

Proteins for UBE2M (7 products)

Catalog No. Species Pres. Purity   Source  

UBE2M (His-tagged)

UBE2M Human Purified > 95.0% by both RP-HPLC and SDS-PAGE analyses E. coli
  OriGene Technologies GmbH

UBE2M (His-tagged)

UBE2M Human Purified > 95.0% by both RP-HPLC and SDS-PAGE analyses E. coli
  OriGene Technologies GmbH

UBE2M (His-tagged)

UBE2M Human Purified > 95.0% by both RP-HPLC and SDS-PAGE analyses E. coli
  OriGene Technologies GmbH

UBE2M (1-183, His-tag)

UBE2M Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

UBE2M (1-183, His-tag)

UBE2M Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

UBE2M

UBE2M Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBE2M

UBE2M Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBE2M (1 products)

Catalog No. Species Pres. Purity   Source  

UBE2M Lysate

Western Blot: UBE2M Lysate [NBL1-17540] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UBE2M
  Novus Biologicals Inc.
  • LinkedIn