discontinued

H00092912-D01P UBE2Q2 antibody

See related secondary antibodies

Search for all "UBE2Q2"

Quick Overview

Rabbit anti Human UBE2Q2

H00092912-D01P

More Views

  • H00092912-D01P

Product Description for UBE2Q2

Rabbit anti Human UBE2Q2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for UBE2Q2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Ubiquitin carrier protein Q2, Ubiquitin-conjugating enzyme E2 Q2, Ubiquitin-protein ligase Q2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVN8
Immunogen:
UBE2Q2 (NP_775740.1, 1 a.a. ~ 375 a.a) full-length human protein.
AA Sequence:
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSED PNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIE DLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYS VELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALC MELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
GeneID:
92912
Remarks:
Gene Accession: NM_173469.1
Add. information Rabbit polyclonal antibody raised against a full-length human UBE2Q2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 92912

Accessory Products

Proteins and/or Positive Controls

Proteins for UBE2Q2 (7 products)

Catalog No. Species Pres. Purity   Source  

UBE2Q2 (transcript variant 1)

UBE2Q2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UBE2Q2 (1-375, His-tag)

UBE2Q2 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

UBE2Q2 (1-375, His-tag)

UBE2Q2 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

UBE2Q2

UBE2Q2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UBE2Q2

UBE2Q2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UBE2Q2

UBE2Q2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBE2Q2

UBE2Q2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBE2Q2 (4 products)

Catalog No. Species Pres. Purity   Source  

UBE2Q2 293T Cell Transient Overexpression Lysate(Denatured)

UBE2Q2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UBE2Q2 Lysate

Western Blot: UBE2Q2 Lysate [NBL1-17542] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UBE2Q2
  Novus Biologicals Inc.

UBE2Q2 overexpression lysate

UBE2Q2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

UBE2Q2 overexpression lysate

UBE2Q2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn