H00090025-B01P UBE3D antibody

See related secondary antibodies

Search for all "UBE3D"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human UBE3D

H00090025-B01P

Product Description for UBE3D

Mouse anti Human UBE3D.
Product is tested for Western blot / Immunoblot.

Properties for UBE3D

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C6orf157, H10BH, RP4-751H9.1, UBE2CBP, YJR141W
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6J8
Immunogen:
UBE3D (NP_944602.1, 1 a.a. ~ 389 a.a) full-length human protein.
AA Sequence:
MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAEVRLVPSSCRGLQFVVG DGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIKDRKLLRVLPLPSENWGALVGEWCCHPDPFANK SLHPQENDCFIGDSFFLVNLRTSLWQQRPELSPVEMCCVSSDNHCKLEPKANTKVICKRCKVMLGETVSSETTKFY MTEIIIQSSERSFPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVYILLWLLNSDSLVIESLRNSKYIKK FPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLELLLILSKSNANLPSSLRRVN SFQVAFLKM
GeneID:
90025
Add. information Mouse polyclonal antibody raised against a full-length human UBE3D protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for UBE3D (1 products)

Catalog No. Species Pres. Purity   Source  

UBE2CBP Lysate

Western Blot: UBE2CBP Lysate [NBL1-17517] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UBE2CBP
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn